PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr031941.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family TALE
Protein Properties Length: 392aa    MW: 43846 Da    PI: 6.8223
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr031941.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-093183522155
                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  k +yps++++  LA+++gL+++q+ +WF N+R ++
  Pbr031941.1 318 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 352
                  569*****************************885 PP

2ELK414e-14272293122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK qLlrKYsgyLgsLkqEF+
  Pbr031941.1 272 ELKGQLLRKYSGYLGSLKQEFM 293
                  9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.9E-19129173IPR005540KNOX1
PfamPF037901.4E-22130169IPR005540KNOX1
SMARTSM012561.4E-24183234IPR005541KNOX2
PfamPF037912.0E-20187233IPR005541KNOX2
SMARTSM011882.8E-8272293IPR005539ELK domain
PfamPF037896.6E-11272293IPR005539ELK domain
PROSITE profilePS5121311.174272292IPR005539ELK domain
PROSITE profilePS5007112.989292355IPR001356Homeobox domain
SMARTSM003897.4E-13294359IPR001356Homeobox domain
SuperFamilySSF466891.8E-19294368IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-28297357IPR009057Homeodomain-like
CDDcd000863.01E-12304356No hitNo description
PfamPF059207.2E-17312351IPR008422Homeobox KN domain
PROSITE patternPS000270330353IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MEGVGANGTC SMMAFGENSS NGGGMCPMMM MPLMTSSHHA HHSHHHLHQH QHHMNLNPNA  60
DTHNTSTAHQ FRQLPQLPPS NNHHDHQNPH NTSGGSSFLL HNPVAAAASY FMDNNNNDGV  120
GGSSSSSPST VKAKIMSHPH YHRLLASYIN CQKVGAPPEV VARLEEACAS AANIGQMVSS  180
SSESGSLGED PALDQFMEAY CEMLTKYEQE ISKPFKEAMI FIQRIESQFK ALTLSSYDSA  240
GYGDGIDRNN VSSEEEVDVN NNFIDPQAED RELKGQLLRK YSGYLGSLKQ EFMKKRKKGK  300
LPKEARQQLL DWWSRHYKWP YPSESQKLAL AESTGLDQKQ INNWFINQRK RHWKPSEDMQ  360
FVVMDASHQG HYYMDSVMGN PFPMDISPTL L*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1287296LKQEFMKKRK
2293297KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3642320.0DQ364232.1 Prunus dulcis homeodomain protein Kn1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009357491.10.0PREDICTED: homeobox protein SHOOT MERISTEMLESS-like
SwissprotP466081e-148HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLD3IWE90.0D3IWE9_PRUPE; Class I KNOX homeobox transcription factor STM-like 2
STRINGVIT_10s0116g00190.t011e-161(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-135KNOX/ELK homeobox transcription factor